PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678459593
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NF-YB
Protein Properties Length: 239aa    MW: 26529.4 Da    PI: 4.9224
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678459593genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB74.12.2e-2391179391
      NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                ++d+ lP a +++i+k++lP + ++++d+++++ ec +efi +++se+++ c+re+++ti+++ +l al  lGf +yve++ +  +++r
  678459593  91 KEDASLPKATMTKIIKEMLPPDVRVARDTQDLLIECCVEFINLISSESNEVCNREEKRTIAPEHVLKALEVLGFGEYVEEVYTAYEQHR 179
                6899***************************************************************************9977666666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.9E-3990220IPR009072Histone-fold
SuperFamilySSF471134.19E-3592221IPR009072Histone-fold
PfamPF008083.3E-2094159IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MVPLRDDELQ FRESAASAMS VSPRDPAKTP FTASRMRICL KFYMILLPIV AVIMYRISNV  60
QNVTSFKSLA APPSLSSVRG MEPSDIVGRT KEDASLPKAT MTKIIKEMLP PDVRVARDTQ  120
DLLIECCVEF INLISSESNE VCNREEKRTI APEHVLKALE VLGFGEYVEE VYTAYEQHRA  180
ETVQDSMKSG KWSNGAEMTE EEAVAQQQRM FAEARARMNG GASAVNPPPV SDAQPKLEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B2e-349221512133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097000.11e-94PREDICTED: protein Dr1 homolog
RefseqXP_011096999.11e-94PREDICTED: protein Dr1 homolog
SwissprotP495922e-88NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A0D2LS173e-94A0A0D2LS17_G
TrEMBLA0A0B0MXM43e-94A0A0B0MXM4_G
TrEMBLA0A061FYD73e-94A0A061FYD7_THECC; Nuclear factor Y, subunit B13 isoform 2
STRINGGLYMA05G07750.15e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38202244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.21e-89nuclear factor Y, subunit B13